☰

Industrial & Scientific

Lab & Scientific Products

Life Science Supplies

GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor) (FITC), 127449-FITC-100ul

GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor) (FITC), 127449-FITC-100ul
- Mab
- 4A5
- Recognizes human GNRHR2. Species Crossreactivity: mouse.
- Supplied as a liquid in PBS, pH 7.2. No preservative added.
- Purified by Protein A affinity chromatography.
Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Country	USA
Brand	United States Biological
Label	United States Biological
Manufacturer	United States Biological
MPN	127449-FITC
NumberOfItems	1
PartNumber	127449-FITC
Publisher	United States Biological
Studio	United States Biological
ReleaseDate	0000-00-00

Customers who purchased this also purchased....

QZUnique Women Flip Flop, Thong Wedge Platform Sandals Arch Support Slippers High Heel Comfortable Cushion Shoes Summer Beach

QZUnique Women Flip Flop, Thong Wedge Platform Sandals Arch Support Slippers High Heel Comfortable Cushion Shoes Summer Beach

Macadamia Professional Tousled Texture Hair Finishing Spray, 8.5 oz

Macadamia Professional Tousled Texture Hair Finishing Spray, 8.5 oz

Bonide Sulfur Plant Fungicide, 4 lb. Ready-to-Use Micronized Spray or Dust for Organic Gardening, Controls Common Diseases

Bonide Sulfur Plant Fungicide, 4 lb. Ready-to-Use Micronized Spray or Dust for Organic Gardening, Controls Common Diseases

NASCAR Thunder 2004 - PlayStation

NASCAR Thunder 2004 - PlayStation

4 Pack Do Not Flush Feminine Products Sign for Bathroom -

4 Pack Do Not Flush Feminine Products Sign for Bathroom - "Please Do Not Flush Anything Except Toilet Paper" | Self-Adhesive Acrylic 9"x3" Black Gold Sign | Clog Prevention for Home/Restaurant/Office

Lucien Piccard Men's 'Volos' Quartz Stainless Steel and Black Leather Casual Watch (Model: LP-10339-02S)

Lucien Piccard Men's 'Volos' Quartz Stainless Steel and Black Leather Casual Watch (Model: LP-10339-02S)

Smiffys Women's One Size Black Satin Charleston Headband (23893)

Smiffys Women's One Size Black Satin Charleston Headband (23893)

LEGO Speed Champions Fast & Furious 1970 Dodge Charger R/T 76912, Toy Muscle Car Model Kit for Kids, Collectible Set with Dominic Toretto Minifigure

LEGO Speed Champions Fast & Furious 1970 Dodge Charger R/T 76912, Toy Muscle Car Model Kit for Kids, Collectible Set with Dominic Toretto Minifigure